MEFV Antibody / Mediterranean fever | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
ABP-PAB-10816	Mediterranean fever (MEFV) polyclonal antibody
SC300033	MEFV (untagged)-Human Mediterranean fever (MEFV), transcript variant 1
RN212057	Mefv (untagged ORF) - Rat Mediterranean fever (Mefv), (10 ug)
abx258934-1096tests	Human Mediterranean Fever (MEFV) ELISA Kit
abx258934-96tests	Human Mediterranean Fever (MEFV) ELISA Kit
MBS2098009-02	Human Mediterranean Fever (MEFV) ELISA Kit
MBS2098009-05	Human Mediterranean Fever (MEFV) ELISA Kit
ELK5506-02	Human MEFV (Mediterranean Fever) ELISA Kit
MBS2704577-01	Human Mediterranean Fever (MEFV) ELISA Kit
SEC617Hu-1x48wellstestplate	Human Mediterranean Fever (MEFV) ELISA Kit

MEFV Antibody / Mediterranean fever

CAT:

800-R31814

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

MEFV Antibody / Mediterranean fever

Description: MEFV (Mediterranean fever) is a human gene that provides instructions for making a protein called pyrin (also known as marenostrin). Pyrin is produced in certain white blood cells (neutrophils, eosinophils and monocytes) that play a role in inflammation and in fighting infection. Inside these white blood cells, pyrin is found with thecytoskeleton, the structural framework that helps to define the shape, size, and movement of a cell. Pyrin's protein structure also allows it to interact with other molecules involved in fighting infection and in the inflammatory response. Although pyrin's function is not fully understood, it likely assists in keeping the inflammation process under control. Research indicates that pyrin helps regulate inflammation by interacting with the cytoskeleton. And Pyrin may direct the migration of white blood cells to sites of inflammation and stop or slow the inflammatory response when it is no longer needed.
UniProt: O15553
Host: Rabbit
Immunogen: Amino acids PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR of human MEFV were used as the immunogen for the MEFV antibody.
Clonality: Polyclonal
Isotype: IgG
Applications: WB
Format: Antigen affinity purified
Buffer: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Reconstitution: After reconstitution, the MEFV antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitations: This MEFV antibody is available for research use only.

Complementary Product Range

Our range of products, including MEFV Antibody / Mediterranean fever, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
R31814	MEFV Antibody / Mediterranean fever
R33798-100UG	MEFV Antibody
RQ6718	MEFV Antibody / Marenostrin / Pyrin
F54788-0.4ML	ARHGDIA Antibody / RHOGDI Antibody
F54788-0.08ML	ARHGDIA Antibody / RHOGDI Antibody
RQ6462	CLCN5 Antibody / CIC-5 antibody
V2153-20UG	Lambda Light Chain Antibody / Lambda Antibody
V3151-100UG	Lambda Light Chain Antibody / Lambda Antibody
V3151-20UG	Lambda Light Chain Antibody / Lambda Antibody
V3151SAF-100UG	Lambda Light Chain Antibody / Lambda Antibody

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on