ARID1A Antibody
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


ARID1A Antibody
Description:
AT-rich interactive domain-containing protein 1A, also known as p270, is a protein that in humans is encoded by the ARID1A gene. This gene encodes a member of the SWI/SNF families, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. ARID1A is mapped to 1p36.11. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation.Specifications:
Western blot: 0.5-1 µg/mL, Immunofluorescence: 5 µg/mL, Flow cytometry: 1-3ug/million cellsUniProt:
O14497Host:
RabbitReactivity:
Human, Mouse, RatImmunogen:
Amino acids KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR of human ARID1A were used as the immunogen for the ARID1A antibody.Clonality:
PolyclonalIsotype:
IgGApplications:
WB, IF, FACSPurity:
Antigen affinityFormat:
Antigen affinity purifiedBuffer:
Lyophilized from 1X PBS with 2% TrehaloseReconstitution:
After reconstitution, the ARID1A antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.Limitations:
This ARID1A antibody is available for research use only.Storage Conditions:
After reconstitution, the ARID1A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.Formulation:
0.5 mg/mL if reconstituted with 0.2ml sterile DI waterApplications Notes:
Optimal dilution of the ARID1A antibody should be determined by the researcher.CAS Number:
9007-83-4Location:
NuclearImage Legend:
Immunofluorescent staining of FFPE human A549 cells with ARID1A antibody (green) and DAPI nuclear stain (blue) . HIER: steam section in pH6 citrate buffer for 20 min.
