ACTH Antibody

CAT:
800-R31470
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
ACTH Antibody - image 1

ACTH Antibody

  • Description :

    Adrenocorticotropic hormone (ACTH), also known as Corticotropin, is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus) . Its principal effects are increased production and release of corticosteroids. ACTH stimulates secretion of glucocorticoid steroid hormones from adrenal cortex cells, especially in the zona fasciculata of the adrenal glands. This gene can influence steroid hormone secretion by both rapid short-term mechanisms that take place within minutes and slower long-term actions. Besides, ACTH also enhances transcription of mitochondrial genes that encode for subunits of mitochondrial oxidative phosphorylation systems.
  • Specifications :

    IHC (FFPE) : 0.5-1 µg/mL
  • Host :

    Rabbit
  • Reactivity :

    Human, Mouse, Rat
  • Immunogen :

    An amino acid sequence from the middle region of human Adrenocorticotropic hormone (SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF) was used as the immunogen for this ACTH antibody.
  • Clonality :

    Polyclonal
  • Isotype :

    IgG
  • Applications :

    IHC-P
  • Purity :

    Antigen affinity
  • Format :

    Antigen affinity purified
  • Buffer :

    Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
  • Reconstitution :

    After reconstitution, the ACTH antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations :

    This ACTH antibody is available for research use only.
  • Storage Conditions :

    After reconstitution, the ACTH antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation :

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes :

    The stated application concentrations are suggested starting amounts. Titration of the ACTH antibody may be required due to differences in protocols and secondary/substrate sensitivity.
  • CAS Number :

    9007-83-4
  • Image Legend :

    IHC-P: ACTH antibody testing of rat kidney tissue

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide