ACTH Antibody

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
V0001-100uL	ACTH (ABT-ACTH) Antibody
V0001-50uL	ACTH (ABT-ACTH) Antibody
20R-2533	ACTH antibody
10C-CR1096M1	ACTH antibody
GWB-DBF1D1	ACTH Antibody
GWB-Q00966	ACTH Antibody
MBS5316658-01	ACTH antibody
MBS531662-INQUIRE	ACTH antibody
GWB-236742	ACTH Antibody
GWB-Q00649	ACTH Antibody

ACTH Antibody

CAT:

800-R31470

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

Description: Adrenocorticotropic hormone (ACTH), also known as Corticotropin, is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus). Its principal effects are increased production and release of corticosteroids. ACTH stimulates secretion of glucocorticoid steroid hormones from adrenal cortex cells, especially in the zona fasciculata of the adrenal glands. This gene can influence steroid hormone secretion by both rapid short-term mechanisms that take place within minutes and slower long-term actions. Besides, ACTH also enhances transcription of mitochondrial genes that encode for subunits of mitochondrial oxidative phosphorylation systems.
Host: Rabbit
Immunogen: An amino acid sequence from the middle region of human Adrenocorticotropic hormone (SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF) was used as the immunogen for this ACTH antibody.
Clonality: Polyclonal
Isotype: IgG
Applications: IHC-P
Format: Antigen affinity purified
Buffer: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Reconstitution: After reconstitution, the ACTH antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitations: This ACTH antibody is available for research use only.

Complementary Product Range

Our range of products, including ACTH Antibody, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on

Cat	Name
R31470	ACTH Antibody
V9716SAF-100UG	ACTH Recombinant Antibody
V9716-100UG	ACTH Recombinant Antibody
V9067-20UG	Synacthen Antibody / ACTH
V3213-100UG	CLIP Antibody / ACTH
V3212-20UG	CLIP Antibody / ACTH
V3192-20UG	CLIP Antibody / ACTH
V3192-100UG	CLIP Antibody / ACTH
V3191SAF-100UG	CLIP Antibody / ACTH
V2232SAF-100UG	Synacthen Antibody / ACTH