Recombinant JC polyomavirus Small t antigen
CAT:
399-CSB-EP355944JAK-01
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant JC polyomavirus Small t antigen
- CAS Number: 9000-83-3
- UniProt: P03083
- Expression Region: 1-172aa
- Organism: JC polyomavirus (JCPyV) (JCV)
- Target Sequence: MDKVLNREESMELMDLLGLDRSAWGNIPVMRKAYLKKCKELHPDKGGDEDKMKRMNFLYKKMEQGVKVAHQPDFGTWNSSEVGCDFPPNSDTLYCKEWPNCATNPSVHCPCLMCMLKLRHRNRKFLRSSPLVWIDCYCFDCFRQWFGCDLTQEALHCWEKVLGDTPYRDLKL
- Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
- Source: E.coli
- Field of Research: Others
- Assay Type: Developed Protein
- Relevance: Promotes efficient viral genome replication by modulating several host signaling pathways including transport network, interferon production or cell cycle progression. Inhibits host PP2A phosphatase activity and thereby prevents agnoprotein dephosphorylation. Inactivation of PP2A also results in the transactivation of cyclin A and cyclin D1 promoters. In addition, antagonizes the RIG-I/DDX58-mediated IFN response through interaction with E3 ligase TRIM25 leading to the inhibition of 'Lys-63'-linked ubiquitination of DDX58. Inhibits nucleotide excision repair (NER) pathway which leads to DNA strand breaks during DNA replication and micronuclei formation.
- Purity: Greater than 85% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Full Length
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 27.7 kDa
- References & Citations: "The Small t Antigen of JC Virus Antagonizes RIG-I-Mediated Innate Immunity by Inhibiting TRIM25's RNA Binding Ability." Chiang C., Dvorkin S., Chiang J.J., Potter R.B., Gack M.U. MBio 12:0-0 (2021)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.