Recombinant Horse Adiponectin D (ADIPOQ), partial | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS081354-01	Horse Adiponectin ELISA Kit
MBS081354-02	Horse Adiponectin ELISA Kit
MBS081354-03	Horse Adiponectin ELISA Kit
MBS081354-04	Horse Adiponectin ELISA Kit
KLV0045	GENLISA™ Horse Horse Adiponectin (ADP) ELISA
MBS2803030-02	Horse Adiponectin (ADP) ELISA Kit
MBS2803030-04	Horse Adiponectin (ADP) ELISA Kit
E0045HO-48wells	Horse Adiponectin,ADIPOQ ELISA KIT
MBS7606352-01	Horse ADP (Adiponectin) ELISA Kit
MBS7606352-03	Horse ADP (Adiponectin) ELISA Kit

Recombinant Horse Adiponectin D (ADIPOQ), partial

CAT:

399-CSB-EP4093HO-02

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Horse Adiponectin D (ADIPOQ), partial

Gene Name: ADIPOQ
UniProt: F7DZE7
Expression Region: 18-244aa
Organism: Equus caballus
Target Sequence: SYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFSYHITVYLKDVKVSLYKKDKAVLFTYDQYQDKNLDQASGSVLLYLEKGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Tag: Tag-Free
Source: E.coli
Field of Research: Cancer
Assay Type: Developed Protein
Purity: Greater than 85% as determined by SDS-PAGE.
Activity: Not Test
Length: Partial
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 16.0 kDa
References & Citations: "Comparative genomic analysis of eutherian adiponectin genes." Premzl M. Heliyon 4:e00647-e00647 (2018)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Horse Adiponectin D (ADIPOQ), partial, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP4093HO-03	Recombinant Horse Adiponectin D (ADIPOQ), partial
CSB-EP4093HO-01	Recombinant Horse Adiponectin D (ADIPOQ), partial
CSB-EP4093HO-02	Recombinant Horse Adiponectin D (ADIPOQ), partial
CSB-EP4092CA-02	Recombinant Cat Adiponectin (apM1)
CSB-EP4092CA-01	Recombinant Cat Adiponectin (apM1)
CSB-YP661101BO-01	Recombinant Bovine Adiponectin (ADIPOQ)
CSB-EP661101BO-03	Recombinant Bovine Adiponectin (ADIPOQ)
CSB-YP661101BO-02	Recombinant Bovine Adiponectin (ADIPOQ)
CSB-EP723362MO-02	Recombinant Mouse Adiponectin (Adipoq)
CSB-EP723362MO-03	Recombinant Mouse Adiponectin (Adipoq)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on