Recombinant Feline coronavirus Spike glycoprotein (S), Partial

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
Oneq-V177-OneqV177100R	Feline coronavirus
Oneq-V177-OneqV17750R	Feline coronavirus
PCR-V177-PCRV17796R	Feline coronavirus
Oneq-V177-OneqV177150R	Feline coronavirus
PCR-V177-PCRV17748R	Feline coronavirus
NBP0512	Recombinant feline coronavirus protein
MBS569332-02	Coronavirus, Feline Antibody
GWB-526828	Feline Coronavirus Antibody
MBS569331-01	Coronavirus, Feline Antibody
MBS569331-02	Coronavirus, Feline Antibody

CAT:

399-CSB-EP319859FEJ1a2-03

Size:

20 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Feline coronavirus Spike glycoprotein (S), Partial

Gene Name: S
UniProt: P10033
Expression Region: 561-804aa
Organism: Feline coronavirus (strain FIPV WSU-79/1146) (FCoV)
Target Sequence: PMQDNNTDVYCIRSNQFSVYVHSTCKSSLWDNIFNQDCTDVLEATAVIKTGTCPFSFDKLNNYLTFNKFCLSLSPVGANCKFDVAARTRTNEQVVRSLYVIYEEGDNIVGVPSDNSGLHDLSVLHLDSCTDYNIYGRTGVGIIRRTNSTLLSGLYYTSLSGDLLGFKNVSDGVIYSVTPCDVSAQAAVIDGAIVGAMTSINSELLGLTHWTTTPNFYYYSIYNYTSERTRGTAIDSNDVDCEPV
Tag: N-terminal 6xHis-SUMO-tagged
Source: E.coli
Field of Research: Microbiology
Assay Type: Developed Protein
Relevance: S1 region attaches the virion to the cell membrane by interacting with host ANPEP/aminopeptidase N, initiating the infection. Binding to the receptor probably induces conformational changes in the S glycoprotein unmasking the fusion peptide of S2 region and activating membranes fusion. S2 region belongs to the class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) regions assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Not Test
Length: Partial
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 39.9 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Feline coronavirus Spike glycoprotein (S), Partial, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Cat

Name

CSB-EP319859FEJ1-01

Recombinant Feline coronavirus Spike glycoprotein (S), Partial

CSB-EP319859FEJ1a2-01

Recombinant Feline coronavirus Spike glycoprotein (S), Partial

CSB-EP319859FEJ-02

Recombinant Feline coronavirus Spike glycoprotein (S), partial

CSB-EP319859FEJ-03

Recombinant Feline coronavirus Spike glycoprotein (S), partial

CSB-EP319859FEJ1a2-03

Recombinant Feline coronavirus Spike glycoprotein (S), Partial

CSB-EP319859FEJ-01

Recombinant Feline coronavirus Spike glycoprotein (S), partial

CSB-EP319859FEJ1e0-02

Recombinant Feline coronavirus Spike glycoprotein (S), Partial

CSB-EP319859FEJ1-02

Recombinant Feline coronavirus Spike glycoprotein (S), Partial

CSB-EP319859FEJ1a2-02

Recombinant Feline coronavirus Spike glycoprotein (S), Partial

CSB-EP319859FEJ1e0-03

Recombinant Feline coronavirus Spike glycoprotein (S), Partial

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on