Products for Research Use Only
RegisterLogin

PVALB, Human (His)

CAT: 0804-HY-P71129Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P71129Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
PVALB Protein, also known as parvalbumin, plays a key role in muscle tissue by facilitating relaxation after contraction. Its function involves binding two calcium ions, indicating a crucial role in regulating calcium dynamics within muscle cells. Parvalbumin's ability to sequester calcium underscores its significance in fine-tuning the balance between contraction and relaxation, contributing to overall muscle physiology control. PVALB Protein, Human (His) is the recombinant human-derived PVALB protein, expressed by E. coli , with C-6*His labeled tag.
Product Name Alternative
PVALB Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pvalb-protein-human-his.html
Smiles
SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
Molecular Formula
5816 (Gene_ID) P20472 (S2-S110) (Accession)
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-RS11472PVALB Human Pre-designed siRNA Set A
HY-RS26231Pvalb Rat Pre-designed siRNA Set A
HY-RS19735Pvalb Mouse Pre-designed siRNA Set A
HY-P70573A-01IRF5, Human (His)
HY-P705610METTL14, Human (His)
HY-P705479-01SFTPA1, Human (His)
HY-P705446RAF1, Human (His)
HY-P705436TIA1, Human (His)
HY-P705431METTL7B, Human (His)
HY-P705422-01NAT1, Human (His)

Alternative Products

CatalogName
MBS1573581-01Recombinant Human PVALB, N-His
P527953PVALB Protein (C-His, Human)
P507594PVALB Protein (N-His, Human)
HB101012-01Recombinant Human PVALB Protein, N-His
E40KMH1629Recombinant Human PVALB Protein, His Tag
055329-01Parvalbumin (PVALB), Recombinant, Human, His-Tag
591428-01PVALB, Recombinant, Human, His-Tag discontinued
PR00395Recombinant Human PVALB Protein, C-His
TMPY-00483-01Parvalbumin/PVALB Protein, Human, Recombinant (His)
PV033725PVALB Protein Vector (Human) (pPB-C-His)

Popular Products