Recombinant Dendroaspis polylepis polylepis Kunitz-type serine protease inhibitor dendrotoxin E
CAT:
399-CSB-EP360607DBI-02
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Recombinant Dendroaspis polylepis polylepis Kunitz-type serine protease inhibitor dendrotoxin E
- CAS Number: 9000-83-3
- UniProt: P00984
- Expression Region: 1-59aa
- Organism: Dendroaspis polylepis polylepis (Black mamba)
- Target Sequence: LQHRTFCKLPAEPGPCKASIPAFYYNWAAKKCQLFHYGGCKGNANRFSTIEKCRHACVG
- Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
- Source: E.coli
- Field of Research: Others
- Assay Type: Developed Protein
- Relevance: Serine protease inhibitor that inhibits trypsin (Kd=1 nM) and chymotrypsin (Kd=100 nM). May also inhibit voltage-gated potassium channels (Kv). Binds transition metal ions such as copper and cobalt.
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Full Length
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 14.1 kDa
- References & Citations: "Snake venoms. The amino-acid sequence of trypsin inhibitor E of Dendroaspis polylepis polylepis (black mamba) venom." Joubert F.J., Strydom D.J. Eur. J. Biochem. 87:191-198 (1978)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.