Recombinant Rat ATP-sensitive inward rectifier potassium channel 10 (Kcnj10)
CAT:
399-CSB-CF012048RAa0-02
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Rat ATP-sensitive inward rectifier potassium channel 10 (Kcnj10)
- CAS Number: 9000-83-3
- Gene Name: Kcnj10
- UniProt: P49655
- Expression Region: 1-379aa
- Organism: Rattus norvegicus
- Target Sequence: MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVAYHNGKLCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYVADFSLFDQVVKVASPGGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
- Tag: N-terminal 6xHis-tagged
- Source: in vitro E.coli expression system
- Field of Research: Neuroscience
- Assay Type: CF Transmembrane Protein & Developed Protein
- Relevance: May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium. In the kidney, together with KCNJ16, mediates basolateral K (+) recycling in distal tubules; this process is critical for Na (+) reabsorption at the tubules.
- Purity: Greater than 85% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Full Length
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 46.6 kDa
- References & Citations: "Cloning and expression of a family of inward rectifier potassium channels." Bond C.T., Pessia M., XIa X.-M., Lagrutta A., Kavanaugh M.P., Adelman J.P. Recept. Channels 2:183-191 (1994)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.