Recombinant Human Platelet factor 4 protein (PF4) (Active)
CAT:
399-CSB-AP000661HU-03
Size:
5 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Human Platelet factor 4 protein (PF4) (Active)
- CAS Number: 9000-83-3
- Gene Name: PF4, CXCL4, SCYB4
- UniProt: P02776
- Expression Region: 32-101aa
- Organism: Homo sapiens
- Target Sequence: EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
- Tag: Tag-Free
- Source: E.Coli
- Field of Research: Immunology
- Assay Type: Active Protein & In Stock Protein
- Relevance: Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation, the short form is a more potent inhibitor than the longer form. {ECO:0000269|PubMed:7644496}.
- Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
- Purity: >97% as determined by SDS-PAGE.
- Activity: Yes
- Bioactivity: Fully biologically active when compared to standard. The biological activity determined by a chemotaXIs bioassay using human fibroblasts is in a concentration of 1.0-10 ng/ml.
- Length: Full Length of Mature Protein
- Form: Lyophilized powder
- Buffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Function: Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation, the short form is a more potent inhibitor than the longer form.
- Molecular Weight: 7.8 kDa
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.