Recombinant Human Platelet basic protein (PPBP), partial

CAT:
399-CSB-EP018429HU1-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Platelet basic protein (PPBP), partial - image 1

Recombinant Human Platelet basic protein (PPBP), partial

  • Product Name Alternative :

    C-X-C motif chemokine 7Leukocyte-derived growth factor ; LDGFMacrophage-derived growth factor ; MDGFSmall-inducible cytokine B7
  • Abbreviation :

    Recombinant Human PPBP protein, partial
  • Gene Name :

    PPBP
  • UniProt :

    P02775
  • Expression Region :

    59-125aa
  • Organism :

    Homo sapiens (Human)
  • Target Sequence :

    AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDE
  • Tag :

    N-terminal GST-tagged
  • Type :

    Developed Protein
  • Source :

    E.coli
  • Field of Research :

    Immunology
  • Relevance :

    LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2 (73), NAP-2 (74), NAP-2 (1-66), and most potent NAP-2 (1-63) are choattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III (1-81) is more potent than CTAP-III desensitize chokine-induced neutrophil activation.
  • Endotoxin :

    Not test
  • Purity :

    Greater than 90% as determined by SDS-PAGE.
  • Activity :

    Not Test
  • Form :

    Liquid or Lyophilized powder
  • Buffer :

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution :

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function :

    LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2 (73), NAP-2 (74), NAP-2 (1-66), and most potent NAP-2 (1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III (1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation.
  • Molecular Weight :

    34.4 kDa
  • References & Citations :

    Cloning of cDNA coding for connective tissue activating peptide III from a human platelet-derived lambda gt11 expression library.Wenger R.H., Wicki A.N., Walz A., Kieffer N., Clemetson K.J.Blood 73:1498-1503 (1989)
  • Storage Conditions :

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length :

    Partial

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide