Products for Research Use Only

STAT3, Human (His-Sumo)

CAT: 0804-HY-P701097Size: InquireDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P701097Size:Inquire
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
UNSPSC Description
STAT3 is a signal transducer and transcriptional activator that coordinates diverse cellular processes in response to growth factors and cytokines such as interleukin-6 and KITLG/SCF. Upon activation, STAT3 recruits coactivators to target gene promoters, thereby affecting proliferation, differentiation, and immune responses. STAT3 Protein, Human (His-Sumo) is the recombinant human-derived STAT3 protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of STAT3 Protein, Human (His-Sumo) is 191 a.a., with molecular weight of ~38.3 kDa.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/stat3-protein-human-his-sumo.html
Smiles
ESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
Molecular Weight
Approximately 38.3 kDa
Shipping Conditions
Room temperature