Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta

CAT:
399-CSB-EP872766CBGb1-02
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta - image 1

Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta

  • UniProt:

    Q9I840
  • Expression Region:

    24-146aa
  • Organism:

    Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)
  • Target Sequence:

    DCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHLVSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQWSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSFVCKFKA
  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Source:

    E.coli
  • Field of Research:

    Others
  • Assay Type:

    In Stock Protein
  • Relevance:

    Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B. Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase, subsequent activation of PLCgamma2, and platelet activation and aggregation. Binding to GPIbalpha and alpha2/beta-1 may also induce aggregation, but this is controversial.
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Length:

    Full Length of Mature Protein
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    21.8 kDa
  • References & Citations:

    "Rhodocytin (aggretin) activates platelets lacking alpha (2)beta (1) integrin, glycoprotein VI, and the ligand-binding domain of glycoprotein Ibalpha." Bergmeier W., Bouvard D., Eble J.A., Mokhtari-Nejad R., Schulte V., Zirngibl H., Brakebusch C., Fassler R., Nieswandt B. J. Biol. Chem. 276:25121-25126 (2001)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • CAS Number:

    9000-83-3