Recombinant Paraphysa scrofa Kappa-theraphotoxin-Ps1b

• CAS Number:

  9000-83-3

• UniProt:

  P61231

• Expression Region:

  1-31aa

• Organism:

  Paraphysa scrofa (Chilean copper tarantula) (Phrixotrichus auratus)

• Target Sequence:

  YCQKWMWTCDEERKCCEGLVCRLWCKRIINM

• Tag:

  N-terminal 6xHis-KSI-tagged

• Source:

  E.coli

• Field of Research:

  Others

• Assay Type:

  Developed Protein

• Relevance:

  Potent and specific blocker of Kv4.2/KCND2 (IC (50)=34 nM) and Kv4.3/KCND3 (IC (50)=71 nM) potassium channels . Acts by altering the gating properties of these channels .

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Length:

  Full Length

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  19.3 kDa

• References & Citations:

  "Effects of phrixotoxins on the Kv4 family of potassium channels and implications for the role of Ito1 in cardiac electrogenesis." Diochot S., Drici M.-D., Moinier D., Fink M., Lazdunski M. Br. J. Pharmacol. 126:251-263 (1999)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.