Recombinant Paraphysa scrofa Kappa-theraphotoxin-Ps1b
CAT:
399-CSB-EP352188PCN-02
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Paraphysa scrofa Kappa-theraphotoxin-Ps1b
- CAS Number: 9000-83-3
- UniProt: P61231
- Expression Region: 1-31aa
- Organism: Paraphysa scrofa (Chilean copper tarantula) (Phrixotrichus auratus)
- Target Sequence: YCQKWMWTCDEERKCCEGLVCRLWCKRIINM
- Tag: N-terminal 6xHis-KSI-tagged
- Source: E.coli
- Field of Research: Others
- Assay Type: Developed Protein
- Relevance: Potent and specific blocker of Kv4.2/KCND2 (IC (50)=34 nM) and Kv4.3/KCND3 (IC (50)=71 nM) potassium channels . Acts by altering the gating properties of these channels .
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Full Length
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 19.3 kDa
- References & Citations: "Effects of phrixotoxins on the Kv4 family of potassium channels and implications for the role of Ito1 in cardiac electrogenesis." Diochot S., Drici M.-D., Moinier D., Fink M., Lazdunski M. Br. J. Pharmacol. 126:251-263 (1999)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.