Products for Research Use Only
RegisterLogin

BLNK, Human (His)

CAT: 0804-HY-P7667Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7667Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
BLNK Protein, Human (His) expresses in E. coliwith a His tag. B-cell linker protein (BLNK) is an adaptor protein that orchestrates signalling downstream of B-cell receptors[1].
Product Name Alternative
BLNK Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/blnk-protein-human-his.html
Smiles
MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEQQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVSHHHHHH
Molecular Formula
29760 (Gene_ID) AAH18906 (M1-S456) (Accession)
Molecular Weight
Approximately 40-80 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Soini L, et al. A biophysical and structural analysis of the interaction of BLNK with 14-3-3 proteins. J Struct Biol. 2020;212 (3) :107662.|[2]Taguchi T, et al. Deficiency of BLNK hampers PLC-gamma2 phosphorylation and Ca2+ influx induced by the pre-B-cell receptor in human pre-B cells. Immunology. 2004;112 (4) :575-582.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P75474BLNK, Human (HEK293, His)
HY-RS01522BLNK Human Pre-designed siRNA Set A
HY-P85057BLNK Antibody (YA4749, Mouse)
HY-P84689-01BLNK Antibody (YA4386, Mouse)
HY-P82537-01BLNK Antibody (YA2282, Rabbit)
HY-RS27819Blnk Rat Pre-designed siRNA Set A
HY-RS21300Blnk Mouse Pre-designed siRNA Set A
HY-P76688UBE2F, Human (His)
HY-P71535-01TEAD4, Human (His)
HY-P76754-01CABP5, Human (His)

Alternative Products

CatalogName
MBS1575056-01Recombinant Human BLNK, N-His
P522362BLNK Protein (N-His, Human)
TMPY-02191-01BLNK Protein, Human, Recombinant (His)
E40KMPH4115Human BLNK Protein, His Tag
KMH747-01Recombinant Human BLNK Protein, His Tag
PH51836M1BLNK Protein, Human, Recombinant (His Tag)
PR05621Recombinant Human BLNK Protein, N-His
PR00936Recombinant Human BLNK Protein, C-His
PV004114BLNK Protein Vector (Human) (pPB-N-His)
PV327010BLNK Protein Vector (Human) (pPB-His-MBP)

Popular Products