Recombinant Human Interleukin-7 (IL7) (Active)

Recombinant Human Interleukin-7 (IL7) (Active)

• CAS Number: 9000-83-3
• Gene Name: IL-7
• UniProt: P13232
• Expression Region: 26-177aa
• Organism: Homo sapiens
• Target Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
• Tag: Tag free
• Source: Mammalian cell
• Field of Research: Others
• Assay Type: Active Protein & In Stock Protein
• Endotoxin: ≤10 EU/mg by the LAL method
• Purity: Greater than 95% as determined by SDS-PAGE.
• Activity: Yes
• Bioactivity: Measured in a cell proliferation assay using NALM-6 human pre-B cells. The ED50 for this effect is ≤30ng/ml
• Length: Full Length of Mature Protein
• Form: Lyophilized powder
• Buffer: Lyophilized from a 0.2 μm filtered solution containing PBS, 5%mannitoland0.01% Tween 80, pH7.4
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 17.3 kDa
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.