Recombinant Rhesus Macaque Interferon gamma protein (IFNG) (Active)
CAT:
399-CSB-AP003241MOW-01
Size:
10 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Rhesus Macaque Interferon gamma protein (IFNG) (Active)
- CAS Number: 9000-83-3
- Gene Name: IFNG
- UniProt: P63310
- Expression Region: 24-165aa
- Organism: Macaca mulatta (Rhesus macaque)
- Target Sequence: QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ
- Tag: Tag-Free
- Source: E.Coli
- Field of Research: Immunology
- Assay Type: Active Protein & In Stock Protein
- Relevance: Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
- Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
- Purity: >97% as determined by SDS-PAGE.
- Activity: Yes
- Bioactivity: Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using human HeLa cells infected with encephalomyocarditis (EMC) virus is less than 20.0 ng/ml, corresponding to a specific activity of > 5.0 ×104 IU/mg.
- Length: Full Length of Mature Protein
- Form: Lyophilized powder
- Buffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Function: Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
- Molecular Weight: 16.8 kDa
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.