Recombinant Rhesus Macaque Interleukin-3 protein (IL3) (Active)

CAT:
399-CSB-AP001981MOW-01
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Rhesus Macaque Interleukin-3 protein (IL3) (Active) - image 1

Recombinant Rhesus Macaque Interleukin-3 protein (IL3) (Active)

  • Product Name Alternative:

    IL-3, Mast cell growth factor, MCGF, Multipotential colony-stimulating factor, P-cell-stimulating factor
  • Abbreviation:

    Recombinant Rhesus macaque IL3 protein (Active)
  • Gene Name:

    IL3
  • UniProt:

    P25140
  • Expression Region:

    20-143aa
  • Organism:

    Macaca mulatta (Rhesus macaque)
  • Target Sequence:

    APMTQTTSLKTSWAKCSNMIDEIITHLNQPPLPSPDFNNLNEEDQTILVEKNLRRSNLEAFSKAVKSLQNASAIESILKNLPPCLPMATAAPTRPPIRITNGDRNDFRRKLKFYLKTLENEQAQ
  • Tag:

    Tag-Free
  • Type:

    Active Protein & In Stock Protein
  • Source:

    E.Coli
  • Field of Research:

    Immunology
  • Relevance:

    Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.
  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.
  • Purity:

    >98% as determined by SDS-PAGE.
  • Activity:

    Yes
  • Bioactivity:

    Assay #1: Fully biologically active when compared to standard. The ED50 as determined by the dose- dependent stimulation of the proliferation of murine NFS-60 cells is less than 5.0 ng/ml, corresponding to a specific activity of > 2 x 105 IU/mg. Assay #2: The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 x 107 IU/mg.
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 µm filtered PBS, pH 7.4, 5 % trehalose
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; FUNCTION
  • Molecular Weight:

    14.0 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein