Products for Research Use Only

Fas/CD95, Human

CAT: 0804-HY-P7169-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7169-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Fas receptor is a cell surface death receptor, can bind to Fas ligand to form death-inducing signaling complexes, such as Fas associated death domain proteins (FADD) [1][2]. Fas receptor participates in the caspase cascade and regulate the activation of JNK and p38-K downstream. It is also involved in the signaling cascade of ERK/JNK MAPKs, activating MAPK3/ERK1, MAPK8/JNK and NF-κB, which has been implicated in the pathogenesis of various malignant tumors and immune system diseases[3][4]. Human Fas receptor contain a death domain (230-314 a.a.) that plays a key role in regulating programmed death. Fas/CD95 Protein, Human has a full length of 157 amino acids (R17-N173), produced in E.coli with tag free.
Product Name Alternative
Fas/CD95 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd95-tnfrsf6-protein-human.html
Purity
95.0
Smiles
RLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSN
Molecular Formula
355 (Gene_ID) P25445 (R17-N173) (Accession)
Molecular Weight
Approximately 17.6 kDa
References & Citations
[1]Nagata S, et al. The Fas death factor. Science. 1995 Mar 10;267 (5203) :1449-56.|[2]Strasser A, et al. The many roles of FAS receptor signaling in the immune system. Immunity. 2009 Feb 20;30 (2) :180-92.|[3]Liu C, et al. Differential expression of human Fas mRNA species upon peripheral blood mononuclear cell activation. Biochem J. 1995 Sep 15;310 (Pt 3) (Pt 3) :957-63.|[4]Screaton RA, et al. Fas-associated death domain protein interacts with methyl-CpG binding domain protein 4: a potential link between genome surveillance and apoptosis. Proc Natl Acad Sci U S A. 2003 Apr 29;100 (9) :5211-6.|[5]Brenner B, et al. Fas/CD95/Apo-I activates the acidic sphingomyelinase via caspases. Cell Death Differ. 1998 Jan;5 (1) :29-37.|[6]Lee SM, et al. Stimulation of Fas (CD95) induces production of pro-inflammatory mediators through ERK/JNK-dependent activation of NF-κB in THP-1 cells. Cell Immunol. 2011;271 (1) :157-62.|[7]Park DR, et al. Fas (CD95) induces proinflammatory cytokine responses by human monocytes and monocyte-derived macrophages. J Immunol. 2003 Jun 15;170 (12) :6209-16.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins