Recombinant Human Secretin receptor (SCTR)

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS3840663-03	Secretin (human)
MBS3840663-04	Secretin (human)
MBS659563-02	Secretin (human)
MBS142666-04	Human Secretin
067-03	Secretin (Human)
MBS659563-01	Secretin (human)
22060479-1	Human Secretin
22060479-1	Human Secretin
4031250.0001	Secretin (human)
7-02323	Human Secretin

CAT:

399-CSB-CF020865HU-01

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Secretin receptor (SCTR)

Gene Name: SCTR
UniProt: P47872
Expression Region: 23-440aa
Organism: Homo sapiens
Target Sequence: HSTGALPRLCDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLKLKVMYTVGYSSSLVMLLVALGILCAFRRLHCTRNYIHMHLFVSFILRALSNFIKDAVLFSSDDVTYCDAHRAGCKLVMVLFQYCIMANYSWLLVEGLYLHTLLAISFFSERKYLQGFVAFGWGSPAIFVALWAIARHFLEDVGCWDINANASIWWIIRGPVILSILINFILFINILRILMRKLRTQETRGNEVSHYKRLARSTLLLIPLFGIHYIVFAFSPEDAMEIQLFFELALGSFQGLVVAVLYCFLNGEVQLEVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII
Tag: N-terminal 10xHis-tagged
Source: in vitro E.coli expression system
Field of Research: Signal Transduction
Assay Type: CF Transmembrane Protein & Developed Protein
Relevance: Receptor for secretin (SCT), which is involved in different processes such as regulation of the pH of the duodenal content, food intake and water homeostasis. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Upon binding to secretin, regulates the pH of the duodenum by (1) inhibiting the secretion of gastric acid from the parietal cells of the stomach and (2) stimulating the production of bicarbonate (NaHCO (3)) from the ductal cells of the pancreas. In addition to regulating the pH of the duodenal content, plays a central role in diet induced thermogenesis: acts as a non-sympathetic brown fat (BAT) activator mediating prandial thermogenesis, which consequentially induces satiation. Mechanistically, secretin released by the gut after a meal binds to secretin receptor (SCTR) in brown adipocytes, activating brown fat thermogenesis by stimulating lipolysis, which is sensed in the brain and promotes satiation. Also able to stimulate lipolysis in white adipocytes. Also plays an important role in cellular osmoregulation by regulating renal water reabsorption. Also plays a role in the central nervous system: required for synaptic plasticity.
Purity: Greater than 85% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length of Mature Protein
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 53.9 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Secretin receptor (SCTR), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on

Cat	Name
CSB-CF020865HU-02	Recombinant Human Secretin receptor (SCTR)
CSB-CF020865HU-01	Recombinant Human Secretin receptor (SCTR)
CSB-E09017h-01	Human Secretin ELISA Kit
CSB-E09017h-02	Human Secretin ELISA Kit
CSB-E09017h-04	Human Secretin ELISA Kit
CSB-E09017h-03	Human Secretin ELISA Kit
CSB-E17968r-04	Rat Secretin (Sct) ELISA Kit
CSB-E17968r-02	Rat Secretin (Sct) ELISA Kit
CSB-E17968r-01	Rat Secretin (Sct) ELISA Kit
CSB-E17968r-03	Rat Secretin (Sct) ELISA Kit