Recombinant Human TeRatocarcinoma-derived growth factor 1 (TDGF1) , partial

CAT:
399-CSB-EP023343HU1-02
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human TeRatocarcinoma-derived growth factor 1 (TDGF1) , partial - image 1

Recombinant Human TeRatocarcinoma-derived growth factor 1 (TDGF1) , partial

  • CAS Number:

    9000-83-3
  • Gene Name:

    TDGF1
  • UniProt:

    P13385
  • Expression Region:

    32-150aa
  • Organism:

    Homo sapiens
  • Target Sequence:

    GHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD
  • Tag:

    N-terminal 6xHis-tagged
  • Source:

    E.coli
  • Field of Research:

    Developmental Biology
  • Assay Type:

    Developed Protein
  • Relevance:

    Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm.
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Length:

    Partial
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    GPI-anchored cell membrane protein involved in Nodal signaling. Cell-associated TDGF1 acts as a Nodal coreceptor in cis. Shedding of TDGF1 by TMEM8A modulates Nodal signaling by allowing soluble TDGF1 to act as a Nodal coreceptor on other cells
  • Molecular Weight:

    17.5 kDa
  • References & Citations:

    Molecular characterization of a gene of the 'EGF family' expressed in undifferentiated human NTERA2 teratocarcinoma cells.Ciccodicola A., Dono R., Obici S., Zollo M., Persico M.G.EMBO J. 8:1987-1991 (1989)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.