Login

Recombinant Vaccinia virus 3 beta-hydroxysteroid dehydrogenase/Delta 5——》4-isomerase (VACWR170)

CAT:
399-CSB-EP340805VAI-02
Size:
100 µg
Price:
Ask
For price, please contact [email protected]
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Vaccinia virus 3 beta-hydroxysteroid dehydrogenase/Delta 5——》4-isomerase (VACWR170) - image 1
Recombinant Vaccinia virus 3 beta-hydroxysteroid dehydrogenase/Delta 5——》4-isomerase (VACWR170) - image 2
Thumbnail 1
Thumbnail 2

Recombinant Vaccinia virus 3 beta-hydroxysteroid dehydrogenase/Delta 5——》4-isomerase (VACWR170)

  • CAS Number: 9000-83-3
  • Gene Name: VACWR170
  • UniProt: P26670
  • Expression Region: 1-346aa
  • Organism: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
  • Target Sequence: MAVYAVTGGAGFLGRYIVKLLISADDVQEIRVIDIVEDPQPITSKVKVINYIQCDINDFDKVREALDGVNLIIHTAALVDVFGKYTDNEIMKVNYYGTQTILAACVDLGIKYLIYTSSMEAIGPNKHGDPFIGHEHTLYDISPGHVYAKSKRMAEQLVMKANNSVIMNGAKLYTCCLRPTGIYGEGDKLTKVFYEQCKQHGNIMYRTVDDDAVHSRVYVGNVAWMHVLAAKYIQYPGSEIKGNAYFCYDYSPSCSYDMFNLLLMKPLGIEQGSRIPRWMLKMYACKNDMKRILFRKPSLLNNYTLKISNTTFEVRTNNAELDFNYSPIFNVDVAFERTRKWLEESE
  • Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Source: E.coli
  • Field of Research: Others
  • Assay Type: In Stock Protein
  • Relevance: Catalyzes the oxidative conversion of Delta (5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. During viral infection, steroid production contributes to virulence by inhibiting the host inflammatory response.
  • Purity: Greater than 85% as determined by SDS-PAGE.
  • Activity: Not Test
  • Length: Full Length
  • Form: Liquid or Lyophilized powder
  • Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight: 46.9 kDa
  • References & Citations: "Effect of 3-beta-hydroxysteroid dehydrogenase gene deletion on virulence and immunogenicity of different vaccinia viruses and their recombinants." Sroller V., Kutinova L., Nemeckova S., Simonova V., Vonka V. Arch. Virol. 143:1311-1320 (1998)
  • Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.