Recombinant Dendroaspis angusticeps Natriuretic peptide DNP
CAT:
399-CSB-EP329805DBG-03
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Dendroaspis angusticeps Natriuretic peptide DNP
- CAS Number: 9000-83-3
- UniProt: P28374
- Expression Region: 1-38aa
- Organism: Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps)
- Target Sequence: EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA
- Tag: N-terminal 6xHis-KSI-tagged
- Source: E.coli
- Field of Research: Others
- Assay Type: Developed Protein
- Relevance: Exhibits vasodilator, natriuretic and diuretic properties in animal models and human tissues. Acts by stimulating cGMP via the natriuretic peptide receptor A (NPR1). Is a poor agonist of the atrial natriuretic peptide receptor B (NPR2). Is not degraded by neutral endopeptidase (NEP/MME). Binds to atrial natriuretic peptide clearance receptor (NPR-C/NPR3), which may be responsible of the removal of DNP from the circulation. Increases calcium uptake and induces histamine release from rat peritoneal mast cells. Increases calcium-activated potassium (KCa) current in gastric antral circular smooth muscle cells by increasing cGMP production and activating inositol trisphosphate receptors (IP3Rs).
- Purity: Greater than 85% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Full Length
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 19.5 kDa
- References & Citations: "Effects of dendroaspis natriuretic peptide on calcium-activated potassium current and its mechanism." Guo H.-S., Yang Y.-Z., Zou Y., Xu J., Cai Z.-X., Qi Q.-H. J. Physiol. Sci. 58:1-6 (2008)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.