BIN1, Human (His)

• Description :

  The BIN1 protein is essential for controlling plasma membrane curvature and shape and is essential for the formation of T-tubules in muscle cells. It acts as a negative regulator of endocytosis and affects intracellular vesicle sorting. BIN1 Protein, Human (His) is the recombinant human-derived BIN1 protein, expressed by E. coli , with N-His labeled tag.

• Product Name Alternative :

  BIN1 Protein, Human (His), Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/bin1-protein-human-his.html

• Purity :

  96.00

• Smiles :

  MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPRKKSKLFSRLRRKKNSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP

• Molecular Formula :

  274 (Gene_ID) O00499-10 (M1-P424) (Accession)

• Molecular Weight :

  Approximately 54 kDa

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins