Recombinant Mouse Pro-neuropeptide Y (Npy) , partial

Recombinant Mouse Pro-neuropeptide Y (Npy) , partial

• CAS Number: 9000-83-3
• Gene Name: Npy
• UniProt: P57774
• Expression Region: 29-64aa
• Organism: Mus musculus
• Target Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
• Tag: N-terminal hFc-tagged
• Source: Yeast
• Field of Research: Neuroscience
• Assay Type: In Stock Protein
• Relevance: NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
• Purity: Greater than 85% as determined by SDS-PAGE.
• Activity: Not Test
• Length: Partial
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 30.9 kDa
• References & Citations: "Behavioral characterization of neuropeptide Y knockout mice." Bannon A.W., Seda J., Carmouche M., Francis J.M., Norman M.H., Karbon B., McCaleb M.L. Brain Res 868:79-87 (2000)
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.