Recombinant Mycoplasma pneumoniae P30 adhesin (p30) , partial
CAT:
399-CSB-YP301931MLW1-01
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Mycoplasma pneumoniae P30 adhesin (p30) , partial
- CAS Number: 9000-83-3
- Gene Name: p30
- UniProt: P75330
- Expression Region: 106-274aa
- Organism: Mycoplasma pneumoniae (strain ATCC 29342 / M129)
- Target Sequence: RLLEEKERQEQLAEQLQRISAQQEEQQALEQQAAAEAHAEAEVEPAPQPVPVPPQPQVQINFGPRTGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMQPPRPGMPPQPGFPPKR
- Tag: C-terminal 6xHis-tagged
- Source: Yeast
- Field of Research: Epigenetics and Nuclear Signaling
- Assay Type: Developed Protein
- Relevance: Adhesin necessary for successful cytadherence and virulence.
- Purity: Greater than 85% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Partial
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 19.2 kDa
- References & Citations: "Characterization of the gene for a 30-kilodalton adhesion-related protein of Mycoplasma pneumoniae." Dallo S.F., Chavoya A., Baseman J.B. Infect. Immun. 58:4163-4165 (1990)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.