Recombinant Klebsiella pneumoniae Microcin E492 (mceA)

Recombinant Klebsiella pneumoniae Microcin E492 (mceA)

• Gene Name: mceA
• UniProt: Q9Z4N4
• Expression Region: 16-99aa
• Organism: Klebsiella pneumoniae
• Target Sequence: GETDPNTQLLNDLGNNMAWGAALGAPGGLGSAALGAAGGALQTVGQGLIDHGPVNVPIPVLIGPSWNGSGSGYNSATSSSGSGS
• Tag: N-terminal 6xHis-SUMO-tagged
• Source: E.coli
• Field of Research: Others
• Assay Type: Developed Protein
• Relevance: Channel-forming bacteriocin. Forms cation-selective channels. Active on enterobacteria, with highest activity against E.coli. Not active on other Gram-negative bacteria, Gram-positive bacteria or fungi. The unmodified protein is active against E.coli and S.enteritidis. When the siderophore ester is present at Ser-99, antibacterial activity against these species is increased and activity is also detected against E.cloacae and K.pneumoniae. Neutralized by its immunity protein MceB.
• Purity: Greater than 85% as determined by SDS-PAGE.
• Activity: Not Test
• Length: Full Length of Mature Protein
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 20.8 kDa
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.