CTACK/CCL27, Mouse

• Description :

  CTACK/CCL27 protein attracts skin-associated memory T-lymphocytes, mediating lymphocyte homing to the skin. It may also participate in embryonic cell migration. Nuclear forms of CCL27 induce cytoskeletal relaxation. The protein binds to CCR10, exists in monomeric, dimeric, and tetrameric forms, and heparin promotes oligomerization. Additionally, CCL27 interacts with TNFAIP6 through its Link domain. CTACK/CCL27 Protein, Mouse is the recombinant mouse-derived CTACK/CCL27 protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  CTACK/CCL27 Protein, Mouse, Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/ccl27-protein-mouse.html

• Purity :

  96.00

• Smiles :

  LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSHPQQQN

• Molecular Formula :

  20301 (Gene_ID) Q9Z1X0-1 (L26-N120) (Accession)

• Molecular Weight :

  Approximately 10-14 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins