Recombinant Human Myelin transcription factor 1 (MYT1), partial

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS7610118-04	Recombinant Human Myelin PLP
MBS7610118-01	Recombinant Human Myelin PLP
MBS7610118-02	Recombinant Human Myelin PLP
MBS7610118-03	Recombinant Human Myelin PLP
MBS9422403-02	Recombinant Human Myelin protein P0
MBS717146-02	Recombinant Human Myelin P2 protein
MBS717180-03	Recombinant Human Myelin protein P0
MBS9422403-04	Recombinant Human Myelin protein P0
22061100-1	Myelin Oligodendrocyte Glycoprotein Human, Recombinant
22061100-1	Myelin Oligodendrocyte Glycoprotein Human, Recombinant

CAT:

399-CSB-EP015387HU-03

Size:

20 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Myelin transcription factor 1 (MYT1), partial

Gene Name: MYT1
UniProt: Q01538
Expression Region: 900-1101aa
Organism: Homo sapiens
Target Sequence: GLGHISGKYASHRSASGCPLAARRQKEGSLNGSSFSWKSLKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRATFAGKKGKLSGDEVLSPKFKTSDVLENDEEIKQLNQEIRDLNESNSEMEAAMVQLQSQISSMEKNLKNIEEENKLIEEQNEALFLELSGLSQALIQSLANIRLPHMEPICEQNFDAYVSTLTDMYSNQ
Tag: N-terminal 6xHis-tagged
Source: E.coli
Field of Research: Developmental Biology
Assay Type: Developed Protein
Relevance: Binds to the promoter regions of proteolipid proteins of the central nervous syst. May play a role in the development of neurons and oligodendrogalia in the CNS. May regulate a critical transition point in oligodendrocyte lineage development by modulating oligodendrocyte progenitor proliferation relative to terminal differentiation and up-regulation of myelin gene transcription.
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Not Test
Length: Partial
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function: Binds to the promoter region of genes encoding proteolipid proteins of the central nervous system. May play a role in the development of neurons and oligodendroglia in the CNS. May regulate a critical transition point in oligodendrocyte lineage development by modulating oligodendrocyte progenitor proliferation relative to terminal differentiation and up-regulation of myelin gene transcription.
Molecular Weight: 26.1 kDa
References & Citations: Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.DNA Res. 5:355-364 (1998)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Myelin transcription factor 1 (MYT1), partial, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on

Cat	Name
CSB-RP078544h-01	Recombinant Human Myelin P2 protein (PMP2)
CSB-CF018202HU-02	Recombinant Human Myelin proteolipid protein (PLP1)
CSB-CF018202HU-01	Recombinant Human Myelin proteolipid protein (PLP1)
CSB-RP078544h-02	Recombinant Human Myelin P2 protein (PMP2)
CSB-RP078544h-03	Recombinant Human Myelin P2 protein (PMP2)
CSB-YP014774HU-03	Recombinant Human Myelin protein P0 (MPZ), partial
CSB-YP013322HU-02	Recombinant Human Myelin-associated glycoprotein (MAG), partial
CSB-YP013322HU-01	Recombinant Human Myelin-associated glycoprotein (MAG), partial
CSB-YP013322HU-03	Recombinant Human Myelin-associated glycoprotein (MAG), partial
CSB-MP619083HU-01	Recombinant Human Myelin-oligodendrocyte glycoprotein (MOG), partial