IMPA2, Human (His)

• Description :

  IMPA2, or Inositol monophosphatase 2, demonstrates enzymatic activity by utilizing various substrates such as myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP. Additionally, it has been implicated as the pharmacological target for the action of lithium ions (Li⁺) in the brain. IMPA2 Protein, Human (His) is the recombinant human-derived IMPA2 protein, expressed by E. coli , with N-6*His labeled tag.

• Product Name Alternative :

  IMPA2 Protein, Human (His), Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/impa2-protein-human-his.html

• Purity :

  98.0

• Smiles :

  MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK

• Molecular Formula :

  3613 (Gene_ID) O14732-1 (M1-K288) (Accession)

• Molecular Weight :

  Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Dry ice.

• Storage Conditions :

  Stored at -80°C for 1 year

• Scientific Category :

  Recombinant Proteins