Products for Research Use Only
RegisterLogin

4-1BB/TNFRSF9, Human

CAT: 0804-HY-P7125-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7125-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
4-1BB (CD137; TNFRSF9), a receptor of TNFSF9/4-1BBL, belongs to the tumor necrosis factor (TNF) receptor superfamily[1]. 4-1BB is helpful for T cell activation and development, and also induces peripheral mononuclear cell proliferation and migration to the tumor microenvironment[2]. 4-1BB is also involved in enhancing Nrf2 and NF-κB pathway mediated apoptosis of endothelial cells[3]. Human 4-1BB protein is a surface glycoprotein with a transmembrane domain (187-213 a.a.) . 4-1BB/TNFRSF9 Protein, Human is the extracellular part (E19-S184) of 4-1BB protein, produced by E. coli with tag free.
Product Name Alternative
4-1BB/TNFRSF9 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Applications
COVID-19-immunoregulation
Assay Protocol
https://www.medchemexpress.com/cytokines/4-1bbr-tnfrsf9-protein-human.html
Purity
95.0
Smiles
ERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHS
Molecular Formula
3604 (Gene_ID) Q07011 (E19-S184) (Accession)
Molecular Weight
Approximately 17.7 kDa
References & Citations
[1]Wilcox RA, et al. Provision of antigen and CD137 signaling breaks immunological ignorance, promoting regression of poorly immunogenic tumors. J Clin Invest. 2002 Mar;109 (5) :651-9.|[2]Ye L, et al. CD137, an attractive candidate for the immunotherapy of lung cancer. Cancer Sci. 2020 May;111 (5) :1461-1467.|[3]Jiang P, et al. CD137 promotes bone metastasis of breast cancer by enhancing the migration and osteoclast differentiation of monocytes/macrophages. Theranostics. 2019 May 9;9 (10) :2950-2966.|[4]Geng T, et al. CD137 Signaling Promotes Endothelial Apoptosis by Inhibiting Nrf2 Pathway, and Upregulating NF-κB Pathway. Mediators Inflamm. 2020 Jun 6;2020:4321912.|[5]Langstein J, et al. Comparative analysis of CD137 and LPS effects on monocyte activation, survival, and proliferation. Biochem Biophys Res Commun. 2000 Jun 24;273 (1) :117-22.|[6]Langstein J, et al. Identification of CD137 as a potent monocyte survival factor. J Leukoc Biol. 1999 Jun;65 (6) :829-33.|[7]Jiang D, et al. CD137 induces proliferation of murine hematopoietic progenitor cells and differentiation to macrophages. J Immunol. 2008 Sep 15;181 (6) :3923-32.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P72884-014-1BB/TNFRSF9, Mouse (HEK293, His)
HY-P785994-1BB/TNFRSF9, Rabbit (HEK293, His)
HY-P786144-1BB/TNFRSF9, Rat (HEK293, His)
HY-P7447A-014-1BB/TNFRSF9, Mouse (HEK293, C-hFc)
HY-P7447-014-1BB/TNFRSF9, Mouse (HEK293, Fc, solution)
HY-P775744-1BB/TNFRSF9, Mouse (isoform 2, HEK293, His)
HY-P775734-1BB/TNFRSF9, Cynomolgus/Rhesus Macaque (HEK293, His)
HY-P743354-1BB/TNFRSF9, Mouse (isoform 2, HEK293, Fc)
HY-P78794-014-1BB/TNFRSF9, Mouse (Biotinylated, 188a.a, HEK293, His-Avi)
HY-P84962CD137/4-1BB Antibody (YA4654)

Alternative Products

CatalogName
Z02933-204-1BB R/TNFRSF9, Human
Z04980-5004-1BB/TNFRSF9, His, Human
RC214-25R4-1BB Receptor, TNFRSF9, human
K4238-100TNFRSF9/4-1BB (Human) ELISA Kit
MBS4159730-01Recombinant Human 4-1BB Receptor (TNFRSF9)
DY838Human 4-1BB/TNFRSF9 DuoSet ELISA
GTR18838928Human TNFRSF9/4-1BB ELISA Kit
P1273-.1Recombinant Human 4-1BB Receptor/TNFRSF9
OK-0425Human 4-1BB/TNFRSF9 ELISA Kit
E55A13087Human CD137/TNFRSF9/4-1BB Nanobody

Popular Products