C-Type Natriuretic Peptide (1-53), human (TFA)

C-Type Natriuretic Peptide (1-53), human (TFA)

• UNSPSC Description: C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide TFA is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone[1].
• Target Antigen: Angiotensin Receptor
• Type: Peptides
• Related Pathways: GPCR/G Protein
• Applications: Metabolism-protein/nucleotide metabolism
• Field of Research: Endocrinology; Cardiovascular Disease
• Assay Protocol: https://www.medchemexpress.com/c-type-natriuretic-peptide-1-53-human-tfa.html
• Purity: 99.00
• Solubility: 10 mM in DMSO
• Smiles: [DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys37-Cys55) (TFA salt)]
• Molecular Weight: 5801.77 (free acid)
• References & Citations: [1]Minamino N, et al. N-terminally extended form of C-type natriuretic peptide (CNP-53) identified in porcine brain. Biochem Biophys Res Commun. 1990 Jul 31;170(2):973-9.
• Shipping Conditions: Blue Ice
• Storage Conditions: -80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture and light, under nitrogen)
• Clinical Information: No Development Reported