Recombinant Human Palmitoyltransferase ZDHHC5 (ZDHHC5), partial | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS7035668-02	Recombinant Human Palmitoyltransferase ZDHHC15 (ZDHHC15)
MBS7035678-02	Recombinant Human Palmitoyltransferase ZDHHC18 (ZDHHC18)
MBS7035716-02	Recombinant Human Palmitoyltransferase ZDHHC7 (ZDHHC7)
MBS7035724-02	Recombinant Human Palmitoyltransferase ZDHHC9 (ZDHHC9)
MBS9420701-01	Recombinant Human Serine palmitoyltransferase 2
MBS7035662-01	Recombinant Human Palmitoyltransferase ZDHHC13 (ZDHHC13)
MBS7035662-03	Recombinant Human Palmitoyltransferase ZDHHC13 (ZDHHC13)
MBS7035702-03	Recombinant Human Palmitoyltransferase ZDHHC3 (ZDHHC3)
MBS7035708-01	Recombinant Human Palmitoyltransferase ZDHHC5 (ZDHHC5)
MBS7035708-03	Recombinant Human Palmitoyltransferase ZDHHC5 (ZDHHC5)

Recombinant Human Palmitoyltransferase ZDHHC5 (ZDHHC5), partial

CAT:

399-CSB-YP861196HU1-02

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Palmitoyltransferase ZDHHC5 (ZDHHC5), partial

Gene Name: ZDHHC5
UniProt: Q9C0B5
Expression Region: 60-148aa
Organism: Homo sapiens
Target Sequence: ANFSMATFMDPGIFPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRY
Tag: N-terminal 6xHis-tagged
Source: Yeast
Field of Research: Cell Biology
Assay Type: Developed Protein
Relevance: Palmitoyltransferase that catalyzes the addition of palmitate onto various protein substrates such as CTNND2, CD36, STAT3 and S1PR1 thus plays a role in various biological processes including cell adhesion, fatty acid uptake, bacterial sensing or cardiac functions. Plays an important role in the regulation of synapse efficacy by mediating palmitoylation of delta-catenin/CTNND2, thereby increasing synaptic delivery and surface stabilization of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionic acid receptors (AMPARs). Under basal conditions, remains at the synaptic membrane through FYN-mediated phosphorylation that prevents association with endocytic proteins. Neuronal activity enhances the internalization and trafficking of DHHC5 from spines to dendritic shafts where it palmitoylates delta-catenin/CTNND2. Regulates cell adhesion at the plasma membrane by palmitoylating GOLGA7B and DSG2. Plays a role in innate immune response by mediating the palmitoylation of NOD1 and NOD2 and their proper recruitment to the bacterial entry site and phagosomes. Participates also in fatty acid uptake by palmitoylating CD36 and thereby targeting it to the plasma membrane. Upon binding of fatty acids to CD36, gets phosphorylated by LYN leading to inactivation and subsequent CD36 caveolar endocytosis. Controls oligodendrocyte development by catalyzing STAT3 palmitoylation.
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Not Test
Length: Partial
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 12.6 kDa
References & Citations: "Somatostatin receptor 5 is palmitoylated by the interacting ZDHHC5 palmitoyltransferase." Kokkola T., Kruse C., Roy-Pogodzik E.M., Pekkinen J., Bauch C., Honck H.H., Hennemann H., Kreienkamp H.J. FEBS Lett. 585:2665-2670 (2011)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Palmitoyltransferase ZDHHC5 (ZDHHC5), partial, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-CF822734HU-02	Recombinant Human Putative palmitoyltransferase ZDHHC22 (ZDHHC22)
CSB-YP861196HU1-02	Recombinant Human Palmitoyltransferase ZDHHC5 (ZDHHC5), partial
CSB-YP861196HU1-03	Recombinant Human Palmitoyltransferase ZDHHC5 (ZDHHC5), partial
CSB-EP861196HU1-03	Recombinant Human Palmitoyltransferase ZDHHC5 (ZDHHC5), partial
CSB-EP861196HU1-01	Recombinant Human Palmitoyltransferase ZDHHC5 (ZDHHC5), partial
CSB-CF822734HU-01	Recombinant Human Putative palmitoyltransferase ZDHHC22 (ZDHHC22)
CSB-EP861196HU1-02	Recombinant Human Palmitoyltransferase ZDHHC5 (ZDHHC5), partial
CSB-YP861196HU1-01	Recombinant Human Palmitoyltransferase ZDHHC5 (ZDHHC5), partial
CSB-EP022640HU-02	Recombinant Human Serine palmitoyltransferase 2 (SPTLC2), partial
CSB-EP022640HU-01	Recombinant Human Serine palmitoyltransferase 2 (SPTLC2), partial

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on