Recombinant Human FrataXIn, mitochondrial (FxN)

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS7610559-01	Recombinant Human Frataxin
MBS7610559-04	Recombinant Human Frataxin
MBS7610560-03	Recombinant Human Frataxin
MBS7616297-01	Recombinant Human Frataxin
MBS7616297-02	Recombinant Human Frataxin
MBS7616297-03	Recombinant Human Frataxin
7-05217	Recombinant Human Frataxin
7-05215	Recombinant Human Frataxin
MBS7610559-02	Recombinant Human Frataxin
MBS7610560-01	Recombinant Human Frataxin

CAT:

399-CSB-EP613687HU(A4)b1-03

Size:

20 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Human FrataXIn, mitochondrial (FxN)

Gene Name: FxN
UniProt: Q16595
Expression Region: 1-210aa
Organism: Homo sapiens
Target Sequence: MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source: E.coli
Field of Research: Tags & Cell Markers
Assay Type: In Stock Protein
Relevance: Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization; however, the physiological relevance is unsure as reports are conflicting and the function has only been shown using heterologous overexpression systems. Modulates the RNA-binding activity of ACO1.
Purity: Greater than 85% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function: Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe (2+) to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe (2+) to Fe (3+); the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization; however, the physiological relevance is unsure as reports are conflicting and the function has only been shown using heterologous overexpression systems. Modulates the RNA-binding activity of ACO1.
Molecular Weight: 28.1 kDa
References & Citations: "Friedreich's ataXIa: autosomal recessive disease caused by an intronic GAA triplet repeat expansion." Campuzano V., Montermini L., Molto M.D., Pianese L., Cossee M., Cavalcanti F., Monros E., Rodius F., Duclos F., Monticelli A., Zara F., Canizares J., Koutnikova H., Bidichandani S., Gellera C., Brice A., Trouillas P., de Michele G.Pandolfo M. Science 271:1423-1427 (1996)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human FrataXIn, mitochondrial (FxN), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on

Cat	Name
CSB-EP613687HU(A4)-06	Recombinant Human Frataxin, mitochondrial (FXN)
CSB-EP613687HU(A4)b1-06	Recombinant Human Frataxin, mitochondrial (FxN)
CSB-EP613687HU(A4)-01	Recombinant Human FrataXIn, mitochondrial (FXN)
CSB-EP613687HU(A4)b1-02	Recombinant Human FrataXIn, mitochondrial (FxN)
CSB-EP613687HU(A4)-02	Recombinant Human FrataXIn, mitochondrial (FXN)
CSB-EP613687HU(A4)-03	Recombinant Human FrataXIn, mitochondrial (FXN)
CSB-EP613687HU(A4)b1-03	Recombinant Human FrataXIn, mitochondrial (FxN)
CSB-EP613687HU(A4)b1-01	Recombinant Human FrataXIn, mitochondrial (FxN)
CSB-EP613687HU(A4)-05	Human Frataxin, mitochondrial (FXN)
CSB-EP613687HU(A4)b1-04	Human Frataxin, mitochondrial (FxN)