Login

Recombinant Pig Beta-2-microglobulin (B2M)

CAT:
399-CSB-EP4852PI-02
Size:
100 µg
Price:
Ask
For price, please contact [email protected]
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Pig Beta-2-microglobulin (B2M) - image 1
Recombinant Pig Beta-2-microglobulin (B2M) - image 2
Thumbnail 1
Thumbnail 2

Recombinant Pig Beta-2-microglobulin (B2M)

  • CAS Number: 9000-83-3
  • Gene Name: B2M
  • UniProt: Q07717
  • Expression Region: 21-118aa
  • Organism: Sus scrofa
  • Target Sequence: VARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLLKNGEKMNAEQSDLSFSKDWSFYLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH
  • Tag: Tag-free
  • Source: E.coli
  • Field of Research: Others
  • Assay Type: In Stock Protein
  • Relevance: Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system.
  • Purity: Greater than 90% as determined by SDS-PAGE.
  • Activity: Not Test
  • Length: Full Length of Mature Protein
  • Form: Liquid or Lyophilized powder
  • Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight: 11.5 kDa
  • References & Citations: "Crystal structure of swine major histocompatibility complex class I SLA-1 0401 and identification of 2009 pandemic swine-origin influenza A H1N1 virus cytotoxic T lymphocyte epitope peptides." Zhang N., Qi J., Feng S., Gao F., Liu J., Pan X., Chen R., Li Q., Chen Z., Li X., XIa C., Gao G.F. J Virol 85:11709-11724 (2011)
  • Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.