Recombinant Pig Beta-2-microglobulin (B2M)

Recombinant Pig Beta-2-microglobulin (B2M)

• CAS Number: 9000-83-3
• Gene Name: B2M
• UniProt: Q07717
• Expression Region: 21-118aa
• Organism: Sus scrofa
• Target Sequence: VARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLLKNGEKMNAEQSDLSFSKDWSFYLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH
• Tag: Tag-free
• Source: E.coli
• Field of Research: Others
• Assay Type: In Stock Protein
• Relevance: Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Activity: Not Test
• Length: Full Length of Mature Protein
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 11.5 kDa
• References & Citations: "Crystal structure of swine major histocompatibility complex class I SLA-1 0401 and identification of 2009 pandemic swine-origin influenza A H1N1 virus cytotoxic T lymphocyte epitope peptides." Zhang N., Qi J., Feng S., Gao F., Liu J., Pan X., Chen R., Li Q., Chen Z., Li X., XIa C., Gao G.F. J Virol 85:11709-11724 (2011)
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.