Recombinant Human Tissue factor (F3), partial

• Product Name Alternative:

  Tissue Factor; TF; Coagulation Factor III; Thromboplastin; CD142; F3

• Abbreviation:

  Recombinant Human F3 protein, partial

• Gene Name:

  F3

• UniProt:

  P13726

• Expression Region:

  33-251aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

• Tag:

  Tag free

• Type:

  In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Others

• Endotoxin:

  ＜ 1 EU/mg as determined by LAL test.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Not test

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from 0.22 μm filtered solution in PBS, 5%mannital, 0.01% Tween80 pH7.4.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  24.8 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial