Recombinant Escherichia coli Glutamate/aspartate import permease protein GltK (gltK) , partial

CAT:
399-CSB-EP360152ENV1-03
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Escherichia coli Glutamate/aspartate import permease protein GltK (gltK) , partial - image 1

Recombinant Escherichia coli Glutamate/aspartate import permease protein GltK (gltK) , partial

  • CAS Number:

    9000-83-3
  • Gene Name:

    gltK
  • UniProt:

    P0AER5
  • Expression Region:

    113-154aa
  • Organism:

    Escherichia coli (strain K12)
  • Target Sequence:

    SEIIRAGIQSISRGQSSAALALGMTHWQSMKLIILPQAFRAM
  • Tag:

    N-terminal GST-tagged
  • Source:

    E.coli
  • Field of Research:

    Signal Transduction
  • Assay Type:

    Developed Protein
  • Relevance:

    Part of the ABC transporter complex GltIJKL involved in glutamate and aspartate uptake. Probably responsible for the translocation of the substrate across the membrane. ; (Microbial infection) Probably transports the toxic C-terminal region of CdiA from P.luminescens strain TTO1 across the inner membrane to the cytoplasm, where CdiA has a toxic effect. Toxin transport is strain-specific, mutations in this gene do not confer resistance to several other tested CdiA toxins.
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Length:

    Partial
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    31.2 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.