Recombinant Mouse Phosphorylated adapter RNA export protein (Phax)
CAT:
399-CSB-EP884932MO-03
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Mouse Phosphorylated adapter RNA export protein (Phax)
- CAS Number: 9000-83-3
- Gene Name: Phax
- UniProt: Q9JJT9
- Expression Region: 2-385aa
- Organism: Mus musculus
- Target Sequence: ALEAGDMEEGQLSDSDSDMTVVPSDRPLQMAKVLGGGSAACAPVSHYRTVKHVDSSEESLDSDDDCSLWKRKRQKCHNTPPKPEPFPFGPSGQKTALNGGKKVNNIWGAVLQEQNQDAVATELGILGMEGSIDRSRQSETYNYLLAKKLAKKESQEYTKELDKDLDEYMHGDKKPGSKEDENGQGHLKRKRPVRDRLGNRVEMNYKGRYEITEEDAPEKVADEIAFRLQEPKKDLIARVVRILGNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSISEEQIKDIFYVENQKEYENKKAARKRRTQLLGKKMKQAIKSLNFQEDDDTSRETFASDTNEALASLDEAQEGPGETKLDAEEAIEVDHPQDLDIF
- Tag: N-terminal 10xHis-tagged
- Source: E.coli
- Field of Research: Others
- Assay Type: Developed Protein
- Relevance: A phosphoprotein adapter involved in the XPO1-mediated U snRNA export from the nucleus. Bridge components required for U snRNA export, the cap binding complex (CBC)-bound snRNA on the one hand and the GTPase Ran in its active GTP-bound form together with the export receptor XPO1 on the other. Its phosphorylation in the nucleus is required for U snRNA export complex assembly and export, while its dephosphorylation in the cytoplasm causes export complex disassembly. It is recycled back to the nucleus via the importin alpha/beta heterodimeric import receptor. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Its compartmentalized phosphorylation cycle may also contribute to the directionality of export. Binds strongly to m7G-capped U1 and U5 small nuclear RNAs (snRNAs) in a sequence-unspecific manner and phosphorylation-independent manner. Also plays a role in the biogenesis of U3 small nucleolar RNA (snoRNA). Involved in the U3 snoRNA transport from nucleoplasm to Cajal bodies. Binds strongly to m7G-capped U3, U8 and U13 precursor snoRNAs and weakly to trimethylated (TMG)-capped U3, U8 and U13 snoRNAs. Binds also to telomerase RNA.
- Purity: Greater than 85% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Full Length of Mature Protein
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 46.7 kDa
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.