Recombinant Human Cannabinoid receptor 1 (CNR1) -VLPs (Active)

Recombinant Human Cannabinoid receptor 1 (CNR1) -VLPs (Active)

• CAS Number: 9000-83-3
• Gene Name: CNR1
• UniProt: P21554
• Expression Region: 1-472aa
• Organism: Homo sapiens
• Target Sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
• Tag: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
• Source: Mammalian cell
• Field of Research: Cardiovascular
• Assay Type: MP-VLP Transmembrane Protein & Active Protein & In Stock Protein
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: The purity information is not available for VLPs proteins.
• Activity: Yes
• Bioactivity: Measured by its binding ability in a functional ELISA. Immobilized Human CNR1 at 10 μg/mL can bind Anti-CNR1 recombinant antibody (CSB-RA005678MA01HU), the EC50 is 41.72-63.54 ng/mL.
• Length: Full Length
• Form: Lyophilized powder
• Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle miXIng. Avoid vigorous shaking or vorteXIng.
• Molecular Weight: 54.6 kDa
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.