Products for Research Use Only
RegisterLogin

Recombinant Mouse Leukemia inhibitory factor (rMuLIF)

CAT: 0384-PR2005-01Size: 1 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-PR2005-01Size:1 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Leukemia Inhibitory Factor (LIF) is a lymphoid factor which promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. LIF has a number of other activities including cholinergic neuron differentiation, control of stem cell pluripotency, bone and fat metabolism, mitogenesis of certain factor dependent cell lines and promotion of megakaryocyte production in vivo. Mouse LIF is a 20 kDa protein containing 181 amino acid residues.
CAS Number
9000-83-3
Endotoxin
Less than 1EU/mg of rmLIF as determined by LAL method.
Purity
>98% by SDS-PAGE and HPLC analyses.
Bioactivity
The activity of mouse LIF is determined by the ability to induce differentiation of murine M1myeloid leukemic cells. The minimum detectable concentration of mouse LIF in this assay is0.5 ng/mL. The specific activity is >1 x 108 units/mg, where 50 units is defined as the amountof mouse LIF required to induce differentiation in 50% of the M1 colonies in 1 mL agarcultures.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
Molecular Weight
Approximately20 kDa, a single non-glycosylated polypeptide chain containing 181 amino acids.
Storage Conditions
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a 0.2μm filtered concentrated solution in 20mM PB, pH 7.4, with 0.02% TWEEN 20.
Host or Source
Escherichia coli.
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China
AA Sequence
MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF

Related Products

CatalogName
PR2014-01Recombinant Murine Epidermal Growth Factor (rMuEGF)
PR2036-01Recombinant Murine Tumor Necrosis Factor-alpha (rMuTNF-α)
PR2016-01Recombinant Murine Glia maturation factor beta (rMuGMF-β)
NBP0246Recombinant Human T cell acute lymphoblastic leukemia antigen
NBP0247Recombinant Human T cell acute lymphoblastic leukemia antigen
PR1093-01Recombinant Human Migration Inhibitor Factor (rHuMIF)
PR1092-01Recombinant Human Migration Inhibitor Factor (rHuMIF)
BS46527Tissue Factor Pathway Inhibitor Recombinant Rabbit mAb
BS46979-01Tissue Factor Pathway Inhibitor Recombinant Rabbit mAb
PR2035-01Recombinant Murine Stromal-Cell Derived Factor-1 alpha/CXCL12 (rMuSDF-1a/CXCL12)

Alternative Products

CatalogName
JOT-PR2005Recombinant Mouse Leukemia inhibitory factor(rMuLIF)
553871Leukemia Inhibitory Factor
397130LIF (Leukemia Inhibitory Factor)
AP79872-01Leukemia inhibitory factor receptor
GTR17705441LEUKEMIA INHIBITORY FACTOR Antibody
L2024-01BLeukemia Inhibitory Factor (LIF)
E21-690LIF/Leukemia inhibitory factor
553872Leukemia Inhibitory Factor discontinued

Popular Products