Recombinant Human GRO-beta (rHuGRO-beta/ CXCL2)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Human GRO-beta (rHuGRO-beta/ CXCL2)
Description:
The three GRO cDNAs encode 107 amino acid precursor proteins from which the N-terminal 34 amino acid residues are cleaved to generate the mature GROs. There are no potential N-linked glycosylation sites in the amino acid sequences. GRO expression is inducible by serum or PDGF and/or by a variety of inflammatory mediators, such as IL-1 and TNF, in monocytes, fibroblasts, melanocytes and epithelial cells. In certain tumor cell lines, GRO is expressed constitutively.Similar to other alpha chemokines, the three GRO proteins are potent neutrophil attractants and activators. In addition, these chemokines are also active toward basophils. All three GROs can bind with high affinity to the IL-8 receptor type B.Endotoxin:
Less than 1EU/mg of rHuGRO-beta/CXCL2 as determined by LAL method.Purity:
>97% by SDS-PAGE and HPLC analyses.Bioactivity:
Fully biologically active when compared to standard. Determined by its ability to chemoattract hCXCR2 transfected 293 cells using a concentration range of 10.0-100.0 ng/ml, corresponding to a Specific Activity of > 1 x 104 IU/mg.Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.Molecular Weight:
7.9 kDa, a single non-glycosylated polypeptide chain containing 73 amino acids.Storage Conditions:
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.Formulation:
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.Host or Source:
Escherichia coli.Recommended Usage:
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in ChinaCAS Number:
9000-83-3AA Sequence:
APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
