Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 3 (EBNA3) , partial
CAT:
399-CSB-EP667300EFC-03
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 3 (EBNA3) , partial
- CAS Number: 9000-83-3
- Gene Name: EBNA3
- UniProt: Q3KST2
- Expression Region: 1-138aa
- Organism: Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)
- Target Sequence: MDKDRPGDPALDDNMEEEVPSTSVVQEQVSAGDWENVLIELSDSSSEKEAEDAQLEPAQKGTKRKRVDHDAGGSAPARPMLPPQPDLPGREAILRRFPLDLRTLLQAIGAAATRIDTRAIDQFFGSQISNTEMYIMYA
- Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
- Source: E.coli
- Field of Research: Others
- Assay Type: In Stock Protein
- Relevance: Plays an essential role for activation and immortalization of human B-cells. Represses transcription of viral promoters TP1 and Cp through interaction with host RBPJ, and inhibits EBNA2-mediated activation of these promoters. Since Cp is the promoter for all EBNA mRNAs, EBNA3A probably contributes to a negative autoregulatory control loop.
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Not test
- Length: Partial
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 22.6 kDa
- References & Citations: "A structural basis for varied alphabeta TCR usage against an immunodominant EBV antigen restricted to a HLA-B8 molecule." Gras S., Wilmann P.G., Chen Z., Halim H., Liu Y.C., Kjer-Nielsen L., Purcell A.W., Burrows S.R., McCluskey J., Rossjohn J. J Immunol 188:311-321 (2012) .
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.