Recombinant Glutamicibacter nicotianae Adenylate cyclase (cya) (D403A) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS7061209-INQUIRE	Recombinant Cercospora nicotianae Phytoene dehydrogenase (PDH1), partial
MBS1162049-03	Recombinant Cercospora nicotianae Pyridoxine biosynthesis protein PDX1 (PDX1)
MBS1162049-01	Recombinant Cercospora nicotianae Pyridoxine biosynthesis protein PDX1 (PDX1)
MBS1162049-05	Recombinant Cercospora nicotianae Pyridoxine biosynthesis protein PDX1 (PDX1)
MBS1162049-02	Recombinant Cercospora nicotianae Pyridoxine biosynthesis protein PDX1 (PDX1)
MBS1162049-04	Recombinant Cercospora nicotianae Pyridoxine biosynthesis protein PDX1 (PDX1)
054-85	TWEAK, recombinant / TNFSF12, recombinant (Human)
abx072018-300g	Recombinant phosphopantetheine adenylyltransferase (PPAT) (Recombinant)
RP008272	CTAGE6P Recombinant Protein (Human) (Recombinant Tag)
RP030292	STAG3L4 Recombinant Protein (Human) (Recombinant Tag)

Recombinant Glutamicibacter nicotianae Adenylate cyclase (cya) (D403A)

CAT:

399-CSB-EP326731BLY(M)-02

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Glutamicibacter nicotianae Adenylate cyclase (cya) (D403A)

Gene Name: cya
UniProt: P27580
Expression Region: 1-403aa (D403A)
Organism: Glutamicibacter nicotianae (Arthrobacter nicotianae)
Target Sequence: MSTEHTNTPRADSPQSAAEAVRGARQHAPAATPAESDPILELAEAMEGPLRIPAHTPEAVRDTVASLEKRLIGGQREFRRREVASEAGVSLHSARKLWRAIGFPELSDDEVFFTEADKKALGTMVGMVREGALTEETAISLMRSVGQMTDRMVVWQIEALVEDMIANQNLSDRQARRQLFSLLPEIIPAIEDLLLYSWRRQLNSAVHRMALRVETGVAAYNQDRGEDDGGTPLPLARAVGFADLVSYTSLSRRMNERTLAQLVQRFEAKCAEIISVGGGRLVKTIGDEVLYVAETPQAGAQIALSLSRELAKDELFPQTRGAVVWGRLLSRLGDIYGPTVNMAARLTSLAEPGTVLTDAITANTLRNDARFVLTAQEITAVRGFGDIQPYELSAGEGAGLVID
Tag: C-terminal 6xHis-tagged
Source: E.coli
Field of Research: Others
Assay Type: Developed Protein
Relevance: Plays essential roles in regulation of cellular metabolism by catalyzing the synthesis of a second messenger, cAMP.
Purity: Greater than 85% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 50.8 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Glutamicibacter nicotianae Adenylate cyclase (cya) (D403A), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP326731BLY-03	Recombinant Glutamicibacter nicotianae Adenylate cyclase (cya)
CSB-EP326731BLY-02	Recombinant Glutamicibacter nicotianae Adenylate cyclase (cya)
CSB-EP326731BLY-01	Recombinant Glutamicibacter nicotianae Adenylate cyclase (cya)
CSB-EP326731BLY(M)-01	Recombinant Glutamicibacter nicotianae Adenylate cyclase (cya) (D403A)
CSB-EP326731BLY(M)-03	Recombinant Glutamicibacter nicotianae Adenylate cyclase (cya) (D403A)
CSB-EP326731BLY(M)-02	Recombinant Glutamicibacter nicotianae Adenylate cyclase (cya) (D403A)
CSB-YP018814PI-01	Recombinant Pig Trypsin
CSB-YP018814PI-03	Recombinant Pig Trypsin
CSB-YP837687MHV	Recombinant Profilin(A42R)
CSB-BP835645MO-02	Recombinant Recombinant Mouse Chitinase domain-containing protein 1 (Chid1)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on