Recombinant Human AP-3 complex subunit beta-2 (AP3B2) , partial

CAT:
399-CSB-EP621662HU-03
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human AP-3 complex subunit beta-2 (AP3B2) , partial - image 1

Recombinant Human AP-3 complex subunit beta-2 (AP3B2) , partial

  • CAS Number:

    9000-83-3
  • Gene Name:

    AP3B2
  • UniProt:

    Q13367
  • Expression Region:

    973-1078aa
  • Organism:

    Homo sapiens
  • Target Sequence:

    APVFMSENEFKKEQGKLMGMNEITEKLMLPDTCRSDHIVVQKVTATANLGRVPCGTSDEYRFAGRTLTGGSLVLLTLDARPAGAAQLTVNSEKMVIGTMLVKDVIQ
  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Source:

    E.coli
  • Field of Research:

    Neuroscience
  • Assay Type:

    Developed Protein
  • Relevance:

    Subunit of non-clathrin- and clathrin-associated adaptor protein complex 3 (AP-3) that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. AP-3 appears to be involved in the sorting of a subset of transmembrane proteins targeted to lysosomes and lysosome-related organelles. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals.
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Length:

    Partial
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    19.0 kDa
  • References & Citations:

    "Autoimmune gait disturbance accompanying adaptor protein-3B2-IgG." Honorat J.A., Lopez-Chiriboga A.S., Kryzer T.J., Komorowski L., Scharf M., Hinson S.R., Lennon V.A., Pittock S.J., Klein C.J., McKeon A. Neurology 93:e954-e963 (2019)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.