Recombinant Human T-cell-specific surface glycoprotein CD28 (CD28) , partial
CAT:
399-CSB-MP004913HU1-01
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

Recombinant Human T-cell-specific surface glycoprotein CD28 (CD28) , partial
- CAS Number: 9000-83-3
- Gene Name: CD28
- UniProt: P10747
- Expression Region: 19-152aa
- Organism: Homo sapiens
- Target Sequence: NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
- Tag: C-terminal hFc-tagged
- Source: Mammalian cell
- Field of Research: Immunology
- Assay Type: Developed Protein
- Relevance: Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation. Isoform 3 enhances CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells.
- Purity: Greater than 85% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Extracellular Domain
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 44.1 kDa
- References & Citations: "A novel costimulatory signaling in human T lymphocytes by a splice variant of CD28." Hanawa H., Ma Y., Mikolajczak S.A., Charles M.L., Yoshida T., Yoshida R., Strathdee C.A., Litchfield D.W., Ochi A. Blood 99:2138-2145 (2002)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.