Products for Research Use Only
RegisterLogin

VSIG1, Human (HEK293, His)

CAT: 0804-HY-P71675Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P71675Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
VSIG1 Protein is a member of the adhesion molecule (JAM) family and is expressed in the normal stomach and testes, as well as in cancers of the stomach, esophagus, and ovary. VSIG1 Protein mediates the activation of Wnt/-catenin signaling pathway, which has tumor inhibition function and reduces the proliferation and migration ability of tumor cells. VSIG1 Protein, Human (HEK293, His) is the recombinant human-derived VSIG1 protein, expressed by HEK293 , with N-His labeled tag.
Product Name Alternative
VSIG1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/vsig1-protein-human-hek-293-his.html
Smiles
VQVTIPDGFVNVTVGSNVTLICIYTTTVASREQLSIQWSFFHKKEMEPISIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPVKENFNPTTGILVIGNLTNFEQGYYQCTAINRLGNSSCEIDLTSSHPE
Molecular Formula
340547 (Gene_ID) Q86XK7-1 (V22-E232) (Accession)
Molecular Weight
Approximately 26.4 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P77955VSIG1, Mouse (HEK293, His)
HY-P70503-01VSIG2, Human (HEK293, His)
HY-P71424-01VSIG4, Human (HEK293, His)
HY-P71426-01VSIG8, Human (HEK293, His)
HY-P76697VSIG2, Human (Biotinylated, HEK293, His)
HY-P72427A-01VSIG8, Mouse (HEK293, His)
HY-P705243-01VSIG4, Human (Biotinylated, HEK293, His-Avi)
HY-P72427-01VSIG8, Mouse (HEK293, His, solution)
HY-P71006-01VSIG4, Mouse (168a.a, HEK293, His)
HY-P76699VSIG4, Mouse (HEK293, His-Fc)

Alternative Products

CatalogName
Z05368-100GPA34/VSIG1, His, Human
MBS189451-01Human VSIG1 Protein, His Tag
E51P91022VSIG1 protein, Human, Recombinant (His)
32-18195-100Recombinant Human VSIG1 Protein, His Tag
TMPK-01076-01GPA34/VSIG1 Protein, Human, Recombinant (His)
PV143290VSIG1 Protein Vector (Human) (pPB-C-His)
PV143291VSIG1 Protein Vector (Human) (pPB-N-His)
PV143293VSIG1 Protein Vector (Human) (pPM-C-His)
E51P01638GPA34/VSIG1 Protein, Human, Recombinant (C-His)
GTR19008428-01Recombinant human Azurocidin, His (HEK293)

Popular Products