Recombinant Calotropis procera Osmotin, partial

• CAS Number:

  9000-83-3

• UniProt:

  P86363

• Expression Region:

  1-40aa

• Organism:

  Calotropis procera (Roostertree) (Asclepias procera)

• Target Sequence:

  ATFTIRNNCPYTIWAAAVPGGGRRLNSGGTWTINVAPGTA

• Tag:

  N-terminal 6xHis-KSI-tagged

• Source:

  E.coli

• Field of Research:

  Others

• Assay Type:

  Developed Protein

• Relevance:

  Has antifungal activity. Inhibits spore germination and mycelia growth in F.solani (IC (50)=67.0 ug/ml), C.gloeosporioides (IC (50)=32.1 ug/ml) and a Neurospora isolate (IC (50)=57.5 ug/ml).

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Length:

  Partial

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  19.5 kDa

• References & Citations:

  "Osmotin purified from the latex of Calotropis procera: Biochemical characterization, biological activity and role in plant defense." Teixeira de Freitas C.D., Sousa Nogueira F.C., Vasconcelos I.M., Abreu Oliveira J.T., Domont G.B., Ramos M.V. Plant Physiol. Biochem. 49:738-743 (2011)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.