Login

Recombinant Human Single Ig IL-1-related receptor (SIGIRR) , partial

CAT:
399-CSB-MP743558HU-03
Size:
1 mg
Price:
Ask
For price, please contact [email protected]
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Single Ig IL-1-related receptor (SIGIRR) , partial - image 1
Recombinant Human Single Ig IL-1-related receptor (SIGIRR) , partial - image 2
Recombinant Human Single Ig IL-1-related receptor (SIGIRR) , partial - image 3
Thumbnail 1
Thumbnail 2
Thumbnail 3

Recombinant Human Single Ig IL-1-related receptor (SIGIRR) , partial

  • CAS Number: 9000-83-3
  • Gene Name: SIGIRR
  • UniProt: Q6IA17
  • Expression Region: 1-118aa
  • Organism: Homo sapiens
  • Target Sequence: MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSH
  • Tag: C-terminal 6xHis-tagged
  • Source: Mammalian cell
  • Field of Research: Immunology
  • Assay Type: Developed Protein
  • Relevance: Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP.
  • Purity: Greater than 90% as determined by SDS-PAGE.
  • Activity: Not Test
  • Length: Partial
  • Form: Liquid or Lyophilized powder
  • Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight: 14.8 kDa
  • References & Citations: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 13:2265-2270 (2003)
  • Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • Protein Length: Partial