Recombinant Dactylis glomerata Pollen allergen Dac g 3, partial
CAT:
399-CSB-EP309006DACa0-03
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Dactylis glomerata Pollen allergen Dac g 3, partial
- CAS Number: 9000-83-3
- UniProt: P93124
- Expression Region: 1-96aa
- Organism: Dactylis glomerata (Orchard grass) (Cock's-foot grass)
- Target Sequence: VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE
- Tag: N-terminal 6xHis-tagged
- Source: E.coli
- Field of Research: Others
- Assay Type: Developed Protein
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Partial
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 15.0 kDa
- References & Citations: "Cloning, sequencing and immunological characterization of Dac g 3, a major allergen from Dactylis glomerata pollen."Guerin-Marchand C., Senechal H., Bouin A.P., Leduc-Brodard V., Taudou G., Weyer A., Peltre G., David B.Mol. Immunol. 33:797-806 (1996)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.